TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0VQY6|Q0VQY6_ALCBS AcrB/AcrD/AcrFa family protein OS=Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) GN=AcrB/AcrD/AcrFa PE=4 SV=1
MARFFIDRPIFAWVIAIIMMMAGALAIYTLPIEQYPTVAPPQVSIAGNYPGASAKTVEDSVTQVIEQQMNGIDNLLYMSS
SSDSFGNAAVNLTFAPGTDPDIAQVQVQNKLQLATPLLPQEVQQQGMQVTKSSDSFLMVAGFTSEDGSLSRADLADYVAS
NVQDPVSRVPGVGQIQLFGSPYAMRVWLDPNKLNKFDLTPQDVTQTIEVQNNQVASGQLGGAPAVEGQQLNATIIAQTRL
EDVDQFENILLKVNPDGSRVFLKDVARVELAAQNYDVQGRYNGQPAAGLAISLATGANALDTAEALRARLAELQPYFPDK
MEMVFPYDTTPFVSISIEEVVHTLFEAIILVFLVMYLFLQNFRATLIPTLAVPVVLLGTFAVLAAFGFSINTLTMFGMVL
AIGLLVDDAIVVVENVERVMHEEGLPPKEATRKSMGQITGALVGIALVLSAVFVPMAFFPGSTGAIYRQFSITIVSAMVL
SVLVALILTPALCATMLKAKDSEHQTDHGFFGWFNRTFDKSSRRYQGSVEKILGRRGRYLFIYVVIVGVLGFSFMRLPSS
FLPEEDQGILFTLVTLPAGSTQEQTVKVLEKMEDYYLNEEASAVDGLFTVAGFSFTGRGQNAGMAFVNLKDWSERDLSVD
GADNVVARAMGYFSTIREAMMFALNPPSIPELGNASGFDFQLLDQSGQGHEALIQARNQMLGMAAQDPRLAGVRPNGLED
SPQYQIDIDQQKAKALGLSISDINSTLQIAWGSSYVNNFVDRGRVKRVYVQADAPYRMLPENVNDWFVRNNQGKMVPFST
FATGHWTYGSPKLERYNGVSSVNIQGNAAPGYSTGDAMDAMEELSAKLPAGFGFEWTGMSYQERQSGDQAPALYVISLLV
VFLCLAALYESWSIPFAVMLVVPLGILGAVLAATFRDLNNDVFFQVGLLTTIGLSAKNAILIAEFALELEQKGEHLLKAT
LEAVRMRLRPILMTSLAFMLGVTPLMISTGAGAGARNAIGTGVFGGMLTATVLAIFFIPLFYVAVRKLSGVPLDGKKKGK
E