TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0VQY7|Q0VQY7_ALCBS Putative membrane protein OS=Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) GN=ABO_0963 PE=4 SV=1
MTRNPLTLALLGGLMLGGCTLAPSYQQPLSPVPAQLGEANGNSASELTLPSWSSLYQSAELQQLIQSALDNNRDLRIAVL
DVAALRAQYQIQRADLYPNLSVDASGSRQRLPSDLSGTGHSTLSDQYGVQVGVTAWELDLFGRVRSLKDASLEKYLASEE
AQRSTQLALVAQVAQSYLTLVSDRQNLAISRETVVAQEDSLALIERRYESGLGSELDVRQAQIALQEARANLASFERQVD
QDYNALAVLVGGPLPTLKSVNLDNDALALVAPVPQGLPSALLTQRPDVQQAEHQLRAANANIGAARAAFFPSIQLTGAYG
TMSSELSGLFDSGSKAWSFIPSISLPIFSGGRNRANLDLAEVRQDQAVASYEKAIQTAFQEVANALQARDTLARQQQAQQ
ALVTATEQSLTLSQQRYEQGADDYLAVLDAQRTLLSARQQLVTLKLQQLTNETELYRALGGGWDAQQPTHVASR