TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0VSL2|Q0VSL2_ALCBS Outer membrane alginate export protein OS=Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) GN=algE PE=4 SV=1
MSRCLSNSASLLLIVLAGNVAAATPLPIHTYDQRLYLTAGESPDYLKPYTDDQTELNGLLRYEPRYYWRSGDSEWHRWDA
QLRAKLLVATGRPSSLQADETDSIREDEHYAELRDAWVRRRMLFGSPSLSLALGRQSYKDEEGVIWDLPMESLNLDYRST
LWRANLAVGQQLTTWRSDGSDLDPRDDGIVRMLAGVGHQWRPGHWWDLQLHYQDDTSGDPEDRLEGLMDARDFTGYWGGV
RLHGEGGEATAVGYTVNALFQQGDLKSYAIDGDGNRVDRENRLLGYLVQGELYSRIDSLDWRPVLGVRAATTDEPSLSVN
DGYFQSRVQSNRRSGVAELSTGVLGDLLDYEMNNLAYAAAWYRQQLWPRAEMEVLTGTVRRLNNSVTVNSPINNPLVDGE
DRLGNVVNVALGWQSFPLALSERRQMQVSARLSYSVFYMGEAYQRPDKNHQLLFVVAGRW