TCDB is operated by the Saier Lab Bioinformatics Group
>Q0WML0|TAP2_ARATH Antigen peptide transporter-like 2 - Arabidopsis thaliana (Mouse-ear cress).
MGNKKLLTGGSSKTHGSGSSYRDPLLQNQEDKPKANGSENGLNDLEHGVVEAANVGFGRVFALAKPDAGKLVIGTIALLI
GSTTNLLVPKFGGMIIDIVSRDVKTPEQQTESLIAVRNAVVIILLIVVIGSICTALRAWLFNSASERVVARLRKDLFRHL
MHQEIAFYDVTKTGELLSRLSEDTQIIKNAATTNLSEALRNVTTALIGVGFMFTSSWKLTLLALVVVPVISVAVKQFGRY
LRELSHTTQAAAAVAASIAEESFGAVRTVRSFAKESYMVSQYSKKVDETLKLGLKQAVLVGLFFGGLNAAFTLSVITVVS
YGAYLTIYGSMTVGALTSFILYSLTVGSSVSSLSSLYTTAMKAAGASRRVFQILDRVSSMSSSGDKCPVGNPDGDVELND
VWFAYPSRPSHMILKGISLRLTPGSKVALVGPSGGGKTTIANLIERFYDPLKGKILLNGVSLMEISHQYLHKQISIVSQE
PILFNCSVEENIAYGFDGEASFTDIENAAKMANAHEFIEAFPDKYNTVVGERGLRLSGGQKQRIAIARALLTNPSVLLLD
EATSALDAESEYLVQDAMDSLMAGRTVLVIAHRLSTVKTADCVAVISDGEVAEKGTHDELLSLNGIYTNLVKRQLQSSSS
VTTL