TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q11069|TMC2_CAEEL Transmembrane channel-like protein 2 OS=Caenorhabditis elegans GN=tmc-2 PE=1 SV=2
MPKSGAHQPLVRHDTDDGGETGQSVKSLADVSEEEIDSRMSRRSSVIADLLSLFRRSSSVLVRPHTRLGNPNFDDDDDEF
DEEDDKEASKDRILKKIQQKKEIIQKLRGQPWYMKRKRRTLKVAQKHLQQQEAKVSKARLYKAEAGRRLTQASRWLDNLK
IYLIPWEAKIRKIESHFGSVVSSYFTFHRWVLGVNITITFIMCMFVVIPEWLADSRTQFGDDRYNKTKAIKVMPPAVRAR
ADELSTVWDFGGYFQYSLLFYGFYSKETFFGETIKYRVPVAYFFCNIFILGFSLFIILRKMAANNRRGTLSSGKTQQYLF
NWKAFTGWDYTIGNPETAGNVYMANVIKFREAINDDKQKPSDKHPWIRFVARVLTNLFICAMYVFSIWAIMQCGTLKGEH
FFAQNATAITISLITLVFPNIFDLLGKIEKLHPRNALRFQLGRVLVLYILNYYTLIYSLMLQLEHLQKEKNASDNPISAL
GHPGDAIGRTIRETVLPRYPVDNNPHTYYSYAPVTTTPIPATSSWTTVLPDFGPFGVYNPKASVTKDDTVFSSPVVETHM
FGPNSDWNETTVNAASPTGATTRASLRMSQGGLCWETIIGQEITKLVTMDLYMTVASIFLIDFLRGLACRYLNLYWPWDL
ERTFPEYGEFKVAENVLHLVNNQGMIWLGLFFVPLLPMLNNIKLIILMYIRGWAAMTCNVPASQIFRASRSSNFFFALLI
LFLFLCTLPVGFVIASKTPSKSCGPFGNQSFFYSVITDVLHENLDKTLVNGIKYSLSPGIIIPVLVLLSLVIYFLIAMVT
GLSQANQDLSFQLMVERTEEKKKIFELAGGKKKKSKDNTFGKQKPKQLLPPPTKGVSSDDDSQHNRSTAKSVSGRQFVPS
LGSVSEVDHSTGEEQSSDSESTTSSLPPKLSLRQRFLVCIGWADPNKYGRHDDIEMEEGGGRLRELSTGSETDSDDEDSE
KSNRDMSYRTAIQSFDQNSQSASASSSKSTTTAPSNSEMRIEITENPLHTYITPLRIEKKSSASSSSSSHQPSSSIEKQA
ARRLLQPISTTHNIRYGVATVENSSQDPTRPPSTDDSLGDPALHEPLWANLNPHSSYTSAMMSPIMNEVMSNDETTDDEK
GRLIPDRPPIPHSPRELKRLKREKDQQSESGSKPSTPRPPRFRISMSPPRKPPSEKNDSDSSNRKYEMRVEKSPKKPKKS
DND