TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q119J0|PHNC1_TRIEI Phosphonates import ATP-binding protein PhnC 1 OS=Trichodesmium erythraeum (strain IMS101) OX=203124 GN=phnC1 PE=3 SV=1
MISLNKLGVTYPNGTEALHNISIELNQGEFTVILGSSGAGKSTLLRCINFLTYPTSGKVIIEGNGDLNHPKILQKHRQRT
GMIFQQHQLIPRQTALKNVLVGRLGYHSTLRSLFPLPKTDQYIALNCLERVGLLEKALTPVQALSGGQQQRVGIARALAQ
KPKFILADEPIASLDPASSHQVLSNLQKICQEDRIGALISLHQVDLALQYAQRIIGLGKGTILFDCNPSEIKKQQLEEIY
QTLSYNPISKTI