TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1
MADSSSTSAFISTLIIYGLTAVVFVWLFLLLRPKNRRVYEPRSLKDIQTIPEEERTEPVPEGYFGWVEYLLSKPHSFLIQ
HTSVDGYFLLRYIGIVGSLSFVGCLLLLPILLPVNATNGNNLQGFELLSFSNVTNKNRFYAHVFLSWIFFGLFTYVIYKE
LYYYVVFRHAMQTTPLYDGLLSSRTVIVTELHKSIAQEGEMQMRFPKASNVAFAYDLSDLQELCKERAKNAAKYEAALNK
VLNKCVKMTRNKTQKQLDKLYNNGTKPKDDLETYVPHKKRPKHRLGKLPLCLGGKKVNTLSYSSKRIGELNEEIHEKQAD
WASNDRQPACFIQFETQLEAQRCYQSVEAILGKKNFGKRLIGYSPEDVNWGSMRLSSKERHSRRAVANTIMVLLIIFWAF
PVAVVGIISNVNFLTDKVPFLRFINNMPTFLMGVITGLLPTIALVVLMSLVPPFIVMLGKLSGCVTRQETDLYSQAWYYA
FAVIQIFLVVTATSSASSTVDSIIDRPRSAMTLLANNLPKASNFYIMYFILKGLTGPTWTILQAVNLLLSKVLGRVLDST
PRQKWNRYNTLATPRMGIVYPGIEILVCIYICYSIIAPILLFFSTVMLTLLYVAYLYNLNYVFGFSFDLKGRNYPRALFQ
IFVGIYLSEVCLLGLFIMAKTWGPLVLEVFWIVVTALAHIYMKRKFIPLFDAVPLSAIRHARGEPGYSYPTSDLGLQEIK
DIADEMKGKYEQDNTHGILTPVTKDDLKKANLIPDNDGSSENGTPSNPFESGSERASLSGSNAESDSIKKLNDTVIKKSS
TLSSSTKDNNESTFVPEGEKFRKFHYSDVEALRNKRPYDEDDHSKHGPEGAVPVNADAGVIYSDPAAVMKEPQAFPPDVL
ETNTWTRRILQFFNPRRSYPFDSVRMRFPLVFNTSIEYDEEYLSSAYTDPCVREKDPIVWCCKDPLGVSKQQIQEARSNG
LDVRDDFTRYDEKGKVIFTYNPPDYEPEAKK