TCDB is operated by the Saier Lab Bioinformatics Group
>Q18120|TWK18_CAEEL TWiK family of potassium channels protein 18 - Caenorhabditis elegans.
MAIVAQGVSTILTTFQKTFKGLLPLIILVAYTLLGAWIFWMIEGENEREMLIEQQKERDELIRRTVYKINQLQIKRQRRL
MTAEEEYNRTAKVLTTFQETLGIVPADMDKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLS
LYCLGSLFAKGCKMLWRFFLKSTRVVSKDLSNKISEAADNIEEGTTAITPSAEKTENNDDDLLSFPISGLLLITVIWVIF
CAVLFTFLEEWDFGTSLYFTLISFTTIGFGDILPSDYDFMPIVGVLLLIGLSLVSTVMTLIQQQIEALASGMKDNIDQEY
ARALNEAREDGEVDEHVDPEEDPENNKKSFDAVISRMNWSKRGLYYLLPDSQKKELAKQSEKKMGRKSIKIQTDNDLLET
LIREEILKAELNNEMHKYTAPRSSHQPKLVYSDVREKEVPIEVVRVEHFNHGNEDYLEHDI