TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q18593|Q18593_CAEEL Protein CLHM-1 OS=Caenorhabditis elegans GN=clhm-1 PE=4 SV=2
MTTSINSVVTVFQNVFTNHGSTLLNGILIATTVGGQSLVRKLTFSCPCAYPLNIYHSLVFMFGPTAALLLIGITVNSTTW
KLAHGFFFRVRDTRHSWKTTCVSWIEVLIQSSVAPIAWLFVVFLDGGYYRCYRSHEFCLISDAILCKNSTILNSYASTSS
FNKISDNGKYCPPCICVPNPTDASYLEAESQIYAWGLLLFSGVAAFLVITCNRMCDKYTLVQRQYVETYKNVETQKFDAV
AKEHASQLAEHNARAFFGQKDWTKRDWDWVSGIPEVNNPLFARLRLIAAEKTQQTMYTPLQLWNDNKGYRIPQPDLQLTQ
IIVDETKED