TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q19127|NPC1_CAEEL Niemann-Pick C1 protein homolog 1 OS=Caenorhabditis elegans GN=ncr-1 PE=1 SV=2
MKQLLIFCLLFGSIFHHGDAGCIMRGLCQKHTENAYGPCVTNDTNVEPTAFDKTHPAYEKMVEFCPHLLTGDNKLCCTPS
QAEGLTKQIAQARHILGRCPSCFDNFAKLWCEFTCSPNQQDFVSISEMKPIEKKEGFTPEYQPAEAYVNTVEYRLSTDFA
EGMFSSCKDVTFGGQPALRVMCTSTPCTLTNWLEFIGTQNLDLNIPIHTKFLLYDPIKTPPSDRSTYMNVNFTGCDKSAR
VGWPACSTSECNKEEYANLIDLDDGKTSGQTCNVHGIACLNIFVMLAFIGSLAVLLCVGFVFTSYDEDYTNLRQTQSGEE
SPKRNRIKRTGAWIHNFMENNARDIGMMAGRNPKSHFFIGCAVLIFCLPGMIYHKESTNVVDMWSSPRSRARQEEMVFNA
NFGRPQRYQQIMLLSHRDFQSSGKLYGPVFHKDIFEELFDILNAIKNISTQDSDGRTITLDDVCYRPMGPGYDCLIMSPT
NYFQGNKEHLDMKSNKEETVSEDDDAFDYFSSEATTDEWMNHMAACIDQPMSQKTKSGLSCMGTYGGPSAPNMVFGKNST
NHQAANSIMMTILVTQRTEPEIQKAELWEKEFLKFCKEYREKSPKVIFSFMAERSITDEIENDAKDEIVTVVIALAFLIG
YVTFSLGRYFVCENQLWSILVHSRICLGMLSVIINLLSSFCSWGIFSMFGIHPVKNALVVQFFVVTLLGVCRTFMVVKYY
AQQRVSMPYMSPDQCPEIVGMVMAGTMPAMFSSSLGCAFSFFIGGFTDLPAIRTFCLYAGLAVLIDVVLHCTIFLALFVW
DTQRELNGKPEFFFPYQIKDLLGAYLIGRQRATDTFMTQFFHFQVAPFLMHRMTRIITGIIFIASFITTVILSSKISVGF
DQSMAFTEKSYISTHFRYLDKFFDVGPPVFFTVDGELDWHRPDVQNKFCTFPGCSDTSFGNIMNYAVGHTEQTYLSGEMY
NWIDNYLEWISRKSPCCKVYVHDPNTFCSTNRNKSALDDKACRTCMDFDYVANSYPKSSIMYHRPSIEVFYRHLRHFLED
TPNSECVFGGRASFKDAISFTSRGRIQASQFMTFHKKLSISNSSDFIKAMDTARMVSRRLERSIDDTAHVFAYSKIFPFY
EQYSTIMPILTTQLFITVVGVFGIICVTLGIDVKGAACAVICQVSNYFHIVAFMYIFNIPVNALSATNLVMSSGILIEFS
VNVLKGYACSLRQRAKDRAESTVGSIGPIILSGPVVTMAGSTMFLSGAHLQIITVYFFKLFLITIVSSAVHALIILPILL
AFGGSRGHGSSETSTNDNDEQHDACVLSPTAESHISNVEEGILNRPSLLDASHILDPLLKAEGGIDKAIDIITIDRSYPS
TPSSLPCTSRMPRAHIEPDLRSL