TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1A708|Q1A708_STRPU Anion exchange protein OS=Strongylocentrotus purpuratus OX=7668 GN=NBC PE=2 SV=1
MDESDVVVDQGNYHSLREADESETSGHHAIYVGVHVPHNEEQQQKNHHHHHHKHRHKGKSKKNGSSHSSANNSSSTADAF
FPNNDPDARPDALLLDKNGDASQRVKFILGDEADDGHESHEIFTEMEELCYGSDGEELEWKEMARWIKYEEDVDVDADRW
SKPHVATLPLHSLFELRTCLINGTVCLDMEADNIVQIADLVLDKLIMSEQLDESKREQVREALLRKHHHQSHKKHRDKRG
SSLLPMIRSLTDIGRSLSQGGAHNTSMEQQAAAQSGIQTSHGSSPNIQNSQTSPSSLMVKGNSGDLGKSETSGSLPKVSS
HHSLKKRLSEARLSIPHNLAGHSLSARHSFMRKIPQGAEASNVLIGEVDFLSRPIIAFVRLQSAVSLGDPTEVPIPRRFL
FILLGPQSGETKRYHEIGRCVATIMSDKVFHDVAYKAKSTKDLLAGIDEFIDSVTVLPPGAWDPNIRIEPPKVVPDQAKR
LSHFQTPNGHAEGIDEEDGGGGGGHNGEHEGLERTGKIFGGLIQDCKRRFPFYLSDFKDAFHLQCLASFIFMYFACITPV
ITFGGLLGEATENRMSALEGLLGASICGVAFHLFSGQPLTILGSTGPILVYEKILFGFCKTQELDYLSFRFWIGLWTMVF
CVILVATDASSFVKYFTRFIEESFSSLISFIFIYESVHKLMKIYKEYPVARYANDNTTYECMCQTATGLFEYDEKDFYTE
SKIDCDSLNGTLVGNWCGKHVPQSDIFFMSLILMLGTFTIAYSLKEFKTTGYFPTIIRTTVSDFAVLIAVVIMVGVDRLF
GVDTPKLLVPSEFKPTSDLRKGWFIHPFNGNGWWTVLAAIIPALLATILVFMDQQITAVIVNRKENKFKKGLGYHLDLLV
VAVMLGICSIMGLPWFVAATVLSINHVNSLRVESECKAPGERPKIVGCREQRVTGVMVFVMIGLATLMTKILSYVPMPVL
YGVFLFMGIASLKGVQFVDRLSLFFMPLKYQPDYIYLRHVGIKKVYLFTFIQLMCLVVPMGIKSTDAAIVFPIMVLGMVV
VRKLMDYVFTKQEVMMLDDVMPEMTKRAKHDRKKKQEEEVAACEQIKNIPGRVQVPLSDGNMLSIPVDKVEFHPEVACIN
IPEDMAKTGVWKALAKNAEGGQVVHRKPHGKEKSSSGGRPNLDLPTIPGSPRESSYLETQRGSIQEVRIEVPEQFRRTPS
PPPTHIGTDNETSV