TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1CVX9|Q1CVX9_MYXXD TonB-dependent receptor OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_7331 PE=3 SV=1
MSKTPQHGACAAVCPYVPVLLVAAMSSCVLALSPSNRPPDAAREPSPASEHAAAGTGTSAHDDVPPFVNTERQAPPAASA
ITSVNSPAEADASPANEPGQLPKEASPPHPITQTADVPSSEETSSHPLPSEQEASLTSASDFEAKEPPSKSTVVRGARPA
QSASEVTLGRDILDAAPRRNAVDLLRAVPGLVASQHSGEGKAQQLFLRGFDALHGQDVELDVGGLPVNEVSHIHALGYAD
INFVIPEVVQTLEVTEGSYRAAQGDFAVAGTVRMNLGVAEPGVHLLGTLGQYGQRRLVATVRPGDDAGTFAAVELGEGRG
FGAQRGYGRASLLAQANATLGDGLTVRALAGSYVTRFDSPGVVREDDLLSGRSDFFSAALGRQGGSVSRHQLLLGVDLPR
TGNGRTKLEVFGILSDLRLRNNFTGFRVDERGDGLEQTNNATTLGARAEHRRSVTAFGRPVALELGLGARRDSVEQTQRR
YRESDGTFFSDEIDAAFTQTDVWGWAEARMPLGRWSFRLGGRADALGVEVFDALAFRDPRYYDGQGYSRSAFGVHLGAKA
GVEYALGDDADAWRLFASYGDGFRSPQARSLSEGERAPFVSIRGAELGSRKDGEHWALQLSLFGSQVDNDFFFDHTVGTT
VYTGQTLRSGVSAALQARPLQGLVTSVSATFAHAYVRASDTLLPYFAPFVARADVGWDGPLTWTGFGGSTLSLGTGLTFI
GPRPLPFSERSATVFLADAHVAIRRGELGLRLEVSNLLDARWRDGEFVYGSRFDPAAAASLVPARHFTAGSPRMASLSLE
VHL