TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1CW72|Q1CW72_MYXXD Efflux transporter, HAE1 family, outer membrane efflux protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_7238 PE=4 SV=1
MNALLLAALLSHAPSFLLAQAGPGTDAGVEPPAARAPALSSETPEPPRFPVSDPLLKPIPPADMQVATWDEALQLLRQRS
TRLYTALAQVEAAAGVQRIALAALLPTLTGTVSVQYNVLNPDATPLLGGGGGGGGVGGGIGGDVGGAQSPGLTRPPFLGL
LNATQPLFNLPSIIALGTAREARRTANLSLAETRRQLTSALAQSLVLVAAQERMAEVNRVNLRTALERLALTERRFELGA
GTRLDVVRVQQDTETARNLVVLGDETLRKARETLGLVLGIPRGVGLVRGVQLETLLQHSRRDCQQLESLDRRADIAVARS
RRTLAERQVSEVKARYAPTLALTSTTLALTVEEGFVTVPVWNIGASLVLPFWDGGAREGQLRQTRAGVEVAKQGLVELER
TASVEVLQARRAVEVADAAARIAGRGRALAEENDRLTRRSFEVGTGTSLELIQTASDLRQAELLLVVREFELEQARVAAF
LTEAACDW