TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1CXB1|Q1CXB1_MYXXD TonB-dependent receptor OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_6845 PE=4 SV=1
MRSSPVWIPTLVLCVLSATGELPVTPPVPLDAPGPVLPTEVPPPEVPATVLLRLTIDRMGEVSQVEVRQSAGVAFDRAAM
SAALRWRFQPARRGEEAIDVRVDVPVTFVPPVHGHHIEPVASGHDGADAPPGVAAAHGSGDARAPGGASSGTESPQAASA
GTSRGASGTEHSALLGPVAQQPPFFSTTVRGASQAPPPVAVGDFHIPVGQLADVPRRSASDLMLLAPGVMLANHGGEGHA
ESIYIRGFDAGEGKDVELRLNGVPLNEVSHAHGHGYADTYFIIPELVESLRVTEGPYDPSQGDFGVAGTVEYQLGLARRG
LTASLSTGSYAARRLSLLWGPPEASEATFVGLLLRQGHGFGPNRSYANAGIMAQVELRVGDESRLRLFGTSYGSRFASPG
VVRETDVVDSRMPCAPDSDSQFFCSYDPNQGGAGQRHILSAELQSRLKRGGRFVQQGYVILRQTRIRDNFTGFLLDTTPP
DGERQRGDNTEGYYRGSTMGLRGRYTPGLTLLGQPQPLELGYVARYDDVRTRSRRLRDSGGVPYATVFDNQVRTTNLGAY
ASLRAAPVSWLTLRGGVRLDTFLFGVDDHNRPTEDRDGPRLPDESLEAYGFFASPRASAEIRLTPRLTWLTSAGLGARSS
DAAALSDAELAPYARVASGETGLGWRLDGPLALEARGAFFATRVSQDFVFDETVGRNQPVGASQRLGAFVSARGTLRDQV
DIQASLAWARATLPVSGASAWKLWDGTVMPYIPELLGRVDASLRGTTLVAGQQVDWNVALGHSAIGPRPLPLDRYSAPIF
LFDVGTRARWKAVEVGLSVENLLDTRWRESEFNYVSNFRGPDAPPSLMATRHFTAGAPRTFMGTLTLHLDLQEDSP