TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1CY80|Q1CY80_MYXXD Putative membrane protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_6520 PE=4 SV=1
MSGDRNPNSHSRFAHAFAGLLVRRPGAVLLVMLALLAVSLWGTSKLHINSNQLDLISQDLEEVKDVKQVIDMVGGSGFLM
VALRSEDEAALKRTADDLAKIMQDDKENVRNVSYKLPVEFIQQNMVLFVKTEDLVEGKRRIMAFLRDKLKRSNPFFIDLG
GSKPVELDMQDLVDKYSSIGKKSIRDDYNISNDKKMLMLLVKPMWDNTEIGKTKDYLERLKGQIDAYSAQPGKVKLVEDY
KLMGDGKTIAYGFTGSYKTTVDDSFAIEESLEPVTLIALGSIFLITIIFFRKLAPTFLVVIGTVVGTIYTLGFTYATVGE
LNMITSILGGILLGFGIDYGIHFVFRTRLELGAGKPYDVAIRDAVMNAGRPAAVAAVVTAGSFFVLMVSEFRGFSQFGFL
AGMGTLILGLTLFCWSAAILALAGRINPELPQKLIGVMKPPPTNSATTGKELRIPKPKMVLGISTAIVALICAAAVPWAG
SEEPPKGVELGFFERLKYGVSFNYNTRALIPDGMSSVLLQDEINERFNISSDPMAIYTKDLDEAEGVYRELTQNAHKYPS
IDQVVSIFTFVPPAETAAANAKVLEEWKAEMQQLEDEGFSVAALPPEMQANADFFKKVLDAKPFDVHGVPANYTAQFRNL
PSAKPENHGYLTYIYASVDLMDGQKMLKFSDETKVIKAAYTPGKFDQDAWDPKAPTVEKEFRAAGATQLYARLARIVLWD
GKVTVVLTAIWILAMHFLDFRNVKLALASVIPLGVGVAMMLGIMALTGLRLNFMNIIILPILLGFGVSHGLYLLHRFLEG
TSPLVALRSVGAAVASSTLTAVVAFAALLAAAHNGLRSMGLVACIGLITTLVVSFTVLAAVMQLMYDRRQRESGASSGEG
GSTGGGKDSEPKAA