TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1CZ66|Q1CZ66_MYXXD Outer membrane efflux protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_6176 PE=4 SV=1
MLAVALSPAEALAQTLTLRESLDTALHNYGDIRAKQSRRDAAEHDVSYTRKSYLPDVVLSAQQTFGTVNALHGTLYSPGG
PSNASTSLPLPEQNWNAAFGALYSVLVHWNVSTFGRLDRQIELSERTHELKQRELELARFQHGVRVTHAYLNLSTAQRIT
HIQKQSVARFEVVLESVQSHAENGLVPGVDVSFARAELANARSLQLKAYDAELLASKELAVLMGVPFREFQLEPTFHQST
PESGEPAHVAPGHPVLAEHEGKVRRSEQEKKVAAAEGLPTLFAFGMLQGRGSGFRSNYAQDPGAFSSGYLGGVGIDRGNT
LVGLGLSWNLASVLRSFSSEAARDARTRALHQEQELVTQELVAQARFAEHKFDLAREVTHHAVLQRDAATEGFRQSKARY
DSGLGTIVELTQATFSATRADVDLELAQNGIWQALLLKSAAAGDLNEFLQQVRGVKKQ