TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1CZJ4|Q1CZJ4_MYXXD TonB-dependent receptor OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_6044 PE=3 SV=1
MPVGSATIPGLTPSGVASASSDDAVGGVDLGAVPYEERVVTASRRAQSSLDAPNATTVITAEDIRLSGATSLPELLRRVP
GADVMALGVGSANVSLRGFNQRIANKVLVLVDGRTEYQDFLGLTIWSSIPISLEEIERIEVIRGPGSALYGANAMLGVVN
IITRAPGTGPRAQFNVTGGTGNTAAGSFVSHGGSGTMRYRAAAGYSQTDKWSRDYASGLPDVTLRGPDPDLGARGARASL
SAVYTFAEGRQVGLSGGVNRFTTEIYPPGLLRNYFIDGVNAFAKGDVELGPLKLKTFWNHISSDAGPQYEATGQRSLVTS
LNSNLFNAELLFARDFELAGTHQLNIGVEGRLKRVDWGDYLGPLREQVHAAFFVQDEWRIVEPLALVASYRVDRHPLLNL
GSPGLAHSPRISALFKPFENHAFRASAASAFREPTFLESYTQLTVPVPGINGVSTLTTGNQQLRPERLTAFELGWRGEAP
ELGIDLDVAVYQNTVRDLIGLSGVSRLPPGQSYDPGTGSYLLGSSSFQNEDAIYTARGAEAGVTLAPVDGLGLKLSASLQ
DVTSDRESAAECGPCNQAPQFRLYGGLTYRSRADLEFGVDAAYTSASTWIEREPAAADPTRIELVSNPLRAYTVVNARVG
YMAVKDTVTVALVGSHLGGAHSQHPFGNRIERRVYATLTVTP