TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1CZY0|Q1CZY0_MYXXD Major facilitator family protein MmrA OS=Myxococcus xanthus (strain DK 1622) GN=mmrA PE=4 SV=1
MPNQRQVSERAVVALIGAVQFVNILDFVMVMPLGPDFAKELGIASSHIGIIGGAYTAAASVAGLAGGYFLDRFDRRKALA
VSMLGLVVATAAGGFATGMSTLMLARVVAGIFGGPATSLSLSIIADLVPVERRGRALGAVMGAFSVASVAGVPMALKLAE
FGGWRVPFFAVAAMGLLVVLGAIFYLPPVRGHLDAGPRKQAGVLELLANRDIQLSYVMTALVMMAGFVLIPNLSAYLQQN
VGYPRDLLWLPYFIGGIASFATLRVAGPMVDRYGSFKVGTVGSALVLLSTYVGFVHLPRWMPVPVIFTLFMVAMGTRNVA
YNTLTSRVPDTPVRARFMSLQSAVQHMAAAVGAFLSARLLTDLPDGTLGGIPRMAGVSMVLTLLLPALLWVVERRVHSRE
QARALAVAPSQGMAVPLSPGADSHA