TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1D0V0|Q1D0V0_MYXXD ABC transporter, ATP-binding protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5584 PE=3 SV=1
MSGIHVQDLGKRFGDRVAVEALSFHVRPGEVFGLLGPNGAGKTTTVRMLTGLLQPTEGEATVWGHRVDRDGEPLRKVVGL
LTEQPGLYDRLTARENLRFFMKLHELDEAAAWPRARHYLERFGLGGREEEPVGGFSKGMRQKLAIVRTLVHDPKVIFLDE
PTSGLDPESARTVRDAVAELASEGRTIVLCSHNLAEVERLCERVAVVKRRLLAMGPVRELRHAGQALEVRVEGEAERFCL
ALAQLPFAPNVLAEGPKLRVMLADDAQAPDVVACLVGAGARVHSAVPTQRPLEEVYLELLREGRG