TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1D0V1|Q1D0V1_MYXXD ABC transporter, permease protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5583 PE=4 SV=1
MAFRPKRALAVFWKDFLDLRKNVGLLVSMMVLPAVMVLVPIGVVWTYVRTPDHADLRSVALFYDPTLPLGASAARFLIDK
TLTDWFGMFLVMPVFVPILIASQSVAGEKERRTLEPLLASPVTAAELVTGKSLAALVPSVAITWTAFVLFCVGVDIVAWP
LVKMPLMPNALWTFGVFVIAPLFAFFGNGVAVLISARVSEARMAQQLSALVVLPIVGMVGGQVAGVLKAGFGYYLLQGAV
VLVLDALLLWASIRLLDRERLVSRWG