TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1D485|Q1D485_MYXXD Transporter, outer membrane receptor (OMR) family OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_4365 PE=3 SV=1
MKTAHARATLLSLVLVMAVPGRAEEPGLLHSPPERAEPRVALQLDGTLVEGRRVLELYVRYRGPGEPYARRPMEREYGDL
YRALIPAEHVVPPGIEYYVEGLTADGQRVPLFQSASRPARVLVGGETPASASIVRPTPPPERRPPPSRTPPRAAPPEPAP
PPERTPPPERSRAQASAPRKDAPPATRQDDSMAALTADLPADAPTEASSSARPSRASAAAGSAPAPREPAAPRSELEEDL
ALYSAEDTLALATRHEAAVRTVPAIGASFSQQQLRSLGARTVADVLDVVPGLSVSRDVQGFHRTAIRGLRNDAEVLFLLN
GHRLNSFFDGKALMNLPVENLERVEVIRGPGSALYGAGAFLGVVNIVTDTSDGVRTAVSVGGYPGQDDRLAVTGNGHISA
GHTAGNLRVFADIDVWSQAGDSTVIENDGLDDESRSQGLRDVTDPAGRTRDERFLFNAGAGVTYAMGDAGRLGASARFLT
ERRSALVGLFDTVGEDSKLGWNVFLADLTWERSFGPDVTLRARAAYDQQSTDRFFQITPHDFSAGTGANRLFEEGMQEQT
RVSVRSLTGSVDADVALGAYNRLSLGAVVEQQSLGEYDYVTNYTLDAQVRPDGLTRPEGLVDLTSGAASRRLNVGLFAQD
QWTVVNALTLTFGVRMDATQLPTVDASGAINGTRFVPTLNPRVGLVFAATDALVLKALYGRAFRAPTLQELVERIPDTEY
NQGRFEGNPRLQPATVDTFELGADLIQSAGDARVRLRANAYVALFGSPIVPVDTSGNIVPLRNRELGVRVYGVEGEARLE
ASKRAYAWLNASISRAEDLELPAQSRLLTDTPQARFNAGVTMPIGAYVNFDVVVRTGAERRNNSRSVLELIRRYKIPSYS
LITAQLRTEPILEHFEVALVAHNLFDNDLRDDVPRPDRVPGLLPREGMSGFLTVRAHY