TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1D4S2|Q1D4S2_MYXXD Outer membrane efflux protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_4176 PE=4 SV=1
MNAFVIAVALAAAPSDSGTPITLDQARAEGRQNVAAIQAMLDVAIADEDVNLSRSVLLPQLSLDASAGKIWFGRRQEFTT
VPDPANPGSFIRNAVETPSTSTQNYDLGLSLTQVIYDRARWKQLEQSGVVRDAQKGQAREEADTSELEAIRRFFTLYRTQ
ATLQVLKATVERSEQQVERAQALFHAGRTGKNEEITATVNLGTDRINYTAMLGQLVNDQSQLAVWLARPGTEVLTAQDPG
VLTTEPPPAPSVNEALASARAYRPLLRTLELRIRAAELKQSIARSEYLPRLMAQGLYNRGGPDASLVFTEPRLQNRFTAA
VGLSWDLFTGLSTGASSRRAEADIRKAQLTLEQTAREIEGEVRAAHRTLEAQLEAARLAAQNVEVATQGLEMQEARFRAG
AGSTLEVRDAQLSLTRAELALLENRIDVEIARYSLQRAMGALSPGESK