TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1D5I8|Q1D5I8_MYXXD Efflux transporter, outer membrane efflux protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_3905 PE=4 SV=1
MHRPRHAITVPLCAWLALTASSASGQQPATEGGAPAASESTKGAPASPPPAESLSTEGGPLTLEQAVQLAAKRNEVALAA
EQQSEAARARLARARAFFFPELTGTGTYTRRLNEVTREVGGQTVVIQRNNAFNANFVASLPLFDARGIFLYRAARRDGDA
AELEAVEARRQIGFEAANAFLATLAQEQVYRAAEQRLAFARQSLQDASARAKAGLASSNDVTRAELEAASAEVQMSNARN
AAQTTRLELGFLLVSSVKGTLASPDVLLSDASRPLQAHASLADGALDRRPDILAARLRVDALEESAKEPLARLLPTLGAS
ATYRLTNEAGLAGRTGDGFLGVNLIWNFFDGGERYAERRERVALARAAELQVQATTRRVDVDIEQARVALENAQAALAQS
DLAVRTARQNAEEQGILYRQGLSTALTVADASLRQFEAEVAYAQSRFALGVALLGLRAAVGLDPLGKEP