TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1D6U5|Q1D6U5_MYXXD Outer membrane efflux protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_3431 PE=4 SV=1
MRLSLLVGAALLAGGCASIQKERGHAEVAALVEERLGRKTRWNQGTPEDAEVARHLDALLKEDLTSDHSVEVALLNNPAL
QATYEDLGVSQADMVQAGLLSNPTLDGSIGFPISGRGASEHEVSLVQDFVDLFTLPLRKRVAREQFMADTLRVAHEALAT
AAKVRKAFSEVQALQQLMELRRMALQAAVAAADLSARLRAAGNITELELASEQAAAEGARLELAEGELALVEAREHLNRL
MGLWGPRTQWTLSEKLPPLPDQEVSLAHLESLAIRHRLDIDAARKQVMLLWNALELARSTRFFGRVDVGVHEHRDADGPR
LFGPTLSLELPIFDQRQALIARLEAQHRQGERRLMELSVNTRSEVRAARARLLALRLVADRYRRVVLPLREKVVEQSQLQ
YNAMQIGLFQLLSAKREQVDAYQGYIEAVRDYWMARADLEQLVGGRLREGSAAPTPSPSQPSQRVPPGPPGPPAQPAPPG
TPSGHGQDVTHGTESPHEHPHD