TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1DA07|Q1DA07_MYXXD Putative membrane protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_2295 PE=4 SV=1
MLRAALLVLVTSCATLVLELAAARLLAPFIGASLHTWTSIIGVVLAGISLGSYAGGRLSERGASFRWLAGLTALGAVLAL
LPLGWVAVLGDGAALRPIPVLPRTFLLTFLGFFPVSFVLAMVTPLALRLLLPDLGRAGRIVGLLYALGTLGSLAGNFLTG
FVLVAWFPVPTIVLTVSGALMLCALLALPKASVSAPPVEPAAPATAGAVTAADAAPSSTGVDLRTRPVLACFLVASASFC
TLAIELAASRILAPTVGVSLLSWTGIIGVVLTGMALGNFLGGHLADRWPRQEVLAGSMLLAAASCLLIPPIHQWLVLKGY
FDGLGLQARIVGYTAAVFLLPVTALGTLSPQVLRLALADVERAGRTVGRLYAWSTAGALLGSFLTGWWLIAKVGVYPLVM
GASLGLVALAAFVGQVWRRPLFVGATAGTLALAGMFGALGLFASPCTEETDYFCIKVNQVEHDGRRLLAMQLDHLTHTMV
DLEDPSYLGYPHGYIHSEVVRHVAARTAEPRVLVIGGGGYVVPRWVETYVPQVRMEVVEIDPAVTRIALERFGVKPDTRI
ASFSLDGRQYLQEMAERGAYDLIVQDAVNDLSVPYHLMTREYDMLVRSLLKPDGLYLLTVIDEIPRGSFLRSALRTMQEV
FPHVELLHDARSGSKGQGVYIVAGSARPMELERLPELLRGVGIEQPRTGRVPRAEIDAYLAAGPALLLTDDFAPVDNLLA
ELFLLREQVAP