TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1DDM3|Q1DDM3_MYXXD Cation efflux system protein CusB OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_0989 PE=4 SV=1
MGRRMLACGTTSEWRSAAPAGAHGEGDIAHYTCPMHPSVKQHGPGACPICGMDLTPVSRAELQSGIIRVDDLRRQRIGVK
TAKVEQSSMDLSLRALGRVTFDEKSLVDVTLKLDGYIHELRVNATGEPVKKGDVLFTLYSPELYAAQQEYLLARQSQSAA
NASLVGAARKRLELWGLSAAQIERVAQRGQPVENMPFLAPASGYVLEKNVVEGAAVKAGERLFRIAPLAKVWVEADVYEQ
DLARVKPGHPVEVTLPYLPGKKYAGSVGYVYPSLQGATRTGRIRIELPNPELELKPDMYADVRFLLQGGAPRLQIPDSAV
IYTGPRRLVFVDLGEGRLRPQEVKLGIKGNGTYEVLEGLSPGDVVVTSGNFLIAAESRIRSATDDFGGSHAAH