TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1DDM8|Q1DDM8_MYXXD Heavy metal efflux transporter, RND family, MFP subunit OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_0984 PE=4 SV=1
MKPLHAAVAALLLLTACKRETPHDAQAHGHDEPPAQAGAHHDDHGEPHVRIASEMLRDLRITTAPVGVRPGGENVTVLGE
LTFSEDAYAEVASPIAARVSAVFVTTGQAVKQGEKLADLRSPELGKARAALQAAQAQAQAARQAAERKRTLADERIIASK
DVQAAEAEAAAAEASVAAARAELVALGVSEEELRGGNVPPGFVLRAPLSGTVVERTARMGQMADPNLPLFCIGDVSSLWL
VVHAFERDAVRIQRGTQARITFAAFPGQEFMAKVGHVGQRVDATSRTIPVRLELDNADGQLRPGMSASAYIPLGDPGAPI
TAVPAAALQRLEGGWVAFLPTDTRGVFERREVGRGRTLGGDVEVLTGLKPGEQVVVEGAFLLKAEAEKLSGGGSDGHAH