TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1DFM0|Q1DFM0_MYXXD TonB-dependent receptor OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_0272 PE=3 SV=1
MRVAFSTRTSARSVVLSRTAPLRAILAALVMTATPVFAQAPGVPGSAPAPAVDPVTQPLPPSEETQPSQPTDTATQPSGI
AAPPAVGDPSTQQPGTESAPTAQQPGVTPAPTAQQPGTEPAPTAQQPGTEAAPTAQQPGVTPAPTAQQPGTEPAPTAQQP
AAPADESMEGISDEAMLAESAVPPPGFTGIYGRVTDEANGEGLIEATVKVVAGAQKQVLTDLDGFYRVALPPGKYDLRVF
YDVYQGRRITGVVVTKGKATKLDVALGADEGAVQEVVVEARADRRAEGALLQERKKAAAVSDAISAQEIARTPDSSASDA
VKRVVSATVVDGRYVLLRGLGGRYSTTLLNGALLPSTEPDEPSVPLDIFPTSLLANLNVVKSYTPDLPGTFAGGTLLIET
NSYPSEFELKPRISLAGDSETTFRERNSQAQGGFGENLGFPSGSRQLPNAIPRDSGLGMSGESSDVLEQQYRSFPNIWQA
RRTTALPNMGLGVSMGDTLRFGNSRLGYLASANYGHRDGVQEGTFARVDRDETGALNARDAARSTQGFETASLSGLGSVG
FQLDRDNELTWFGLYTRGTDTRTFTARGSNIVRGESYESTRLQFVSRQLFFNQLRGFHRLGLLGDAELDWQANLSRVDRD
EPDTRDTLYSDNLSAPSGTPTFPNQPNSGERFFAELGETSTGGSVNVTVPLSAVRLKVGGLTQVSFRDFGARRFRYLLGT
TPVDRTLPPEQLFAPENLGTGIRVRENTRPDDAYDAYLGIFAGYASADVQPTDALRLVGGLRVESSTQQLTLKDPFTGAS
GTENRSEYMNLLPAFNAIYALTPTVNVRAGYSYTLARPTFRELAPFIYFDFVRRRNVSGNPDLLQTRIHNIDARVEWFAG
ENEVLAASAFYKRFQDPIERVIRNPESGDLSFENAAGANTYGLELEARASLARLTETLKAVRVGANLTLIQSDVDLGDPN
VVGAQTNRNRPLQGQSPYVINLNVGYSRPESGTELTVLYNVYGRRISEVGVQGLPDIYEVPFHRVDISLTQQLGSAQLKL
TAANLLNSSVTLRQESVDVQTYKPGVAFSASLGWSL