TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1QCW6|Q1QCW6_PSYCK Putative uncharacterized protein OS=Psychrobacter cryohalolentis (strain K5) GN=Pcryo_0704 PE=4 SV=1
MRDHSSISLSLITNKLTYALVAIAALGAMSSVQAKVLFTDTSISALYGTDYELVPQETLTTVTLEHASTHTWGGVFFFVD
RHQGKENAAGKEFKETYGELAPKLKLAKFDNSFIKQVNLAGQYEFGSNSNGFSQDNYLVGVGADLNVPIPGMKYASASLY
HAFNDKDNADDQQITLTYGWEKNNFVIDGYVDYAFNSEDDSVKDNIHINPQLKYNLQEVLGIDNRLEVGMEYSYWKNKFG
SDKTQNAASALVKFHF