TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q20687|TM237_CAEEL Transmembrane protein 237 homolog OS=Caenorhabditis elegans OX=6239 GN=jbts-14 PE=3 SV=2
MPPTSRPVPPPPKRRISESSSSSDDELTGNNSFRENQQRRFRENNEVGNISDSDNDEVFSHQESQSVGFIETDEERQREE
HAQNSNLRNRRVSYGKIPVPPMSMTVEDIQEAAKHSREDPSGETVEVRRPNDPRRSSVSLDVFKSFRDPHDKRNMPAKDK
TIYVEGPNGKFREMKKGKFWNRDKFDSPKKDAEKKQDEDSVIPFLLKAPGQAYRTQRVYNQIANIIQGFLAGISVMLAIF
SFNLEPEVLLTGYRYMSLPIHAGFMVAFTVGLVSAIDRTGIYEVEHFTSRTRLTATVYNNGLITFIVWFVGLVSTLLCIQ
LESQLAFAPTRIPSEDLVHHWRVFNVLRALTSGLGFLLLAFKPDSDTMAKELREAIYEQLELVTSDPERRRVIITAMKI