TCDB is operated by the Saier Lab Bioinformatics Group
>Q21070|Q21070_CAEEL Putative uncharacterized protein spe-41 - Caenorhabditis elegans.
MVGKEKKESTRLKLSAIKEYLGKYRGVDADNNEGYDGHQKWHENDQVVLQAMAYFYKAVKSKLYSEVRSFLGILLPHGPD
DGRLSSLQSLLMDTSSEESLKEALLLSIAVGSRPLVEFVLVLFVDAPYLERSGSANSPHFPPHMTPLMLACILNNFSIVQ
CLITRGHCIQIPHFITCECKTCKRETVTTHSSTRLVDVMRALSSEAYLWLATDDVFAATCAVARDLQQLASDDQLEYVET
YRDLEMNVQRFLCRISDQAWRVDEFNMMVANRNYCPERMTEISSPRLQMAMDSQMRQFTCSTNSQTTIKSVFRSDWYNYG
IKPKRDAWRFLRACILMPFLVMLHAFMPTKGTTMCVPLARFIAHITMYLVFLIAAILRPTIGFYFAWTDSIEVTVQALEI
FMYAYVMGLALEKGILFYRVGRDGFFAFWWRWFDAALIFIFLFSLIFFTGKWGKREAFDPSSVDRMHWPSFEFSLLHEIC
LAIACVLSILKCFYYAQMMKSIGGSVISVGKCVGKTYTYILIMVAIIVSFSVGLNIIVDPYLNRSTMKIGDQDYTKTTDS
YETIGTSSKNLFWSIFGYLGPSTFTTVVGNTGPNMDPVKHTLNSSTFEILAAVYHGILIITVLNLMTSILVKGADEVLDN
EEMEFKFTRAAIYSEFLSWEMAAPPPLNLILVVAHFVHRNLLKRYYASPAWGEKPANDDVEDQAADEQYMQLLMVVFARF
VASKECKYKSIWRSEFHREEKQPPRVTFLTTGAHSFLMDNTFEGFKMRSSRTMEAEGYKEYTTVQYYVPKSKTPGPAAAA
DAGTKVAPKDDKPQNNPVLARTGIDSPVPSSKQVMSSELSASIPRARDVTFLGV