TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q21E41|Q21E41_SACD2 Putative uncharacterized protein OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=Sde_3783 PE=4 SV=1
MSLKDIVNPFSWFSKGVETVGDTVVNVKKTFTGSKADQDQYAHEQFISGLEGYSKEFTNRANRTWWDSLWDGVNRMPRPL
IVVAIFWYFSLSYRNPEEFQVLNLALDTVPERMWWIMSAVVSFYFVAREFQKGRDTKLALSDKEFKTVQDRMAKLREAAV
TELPAKEPGYKNPSIEEWKQKAGINR