TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q21EL6|Q21EL6_SACD2 Uncharacterized protein OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=Sde_3608 PE=4 SV=1
MNKINGLKREIKFLARDRIIWLWLALVFCLSSAAVGFGLAEIAVQNKTIEQLIQADKTDRALQHSKKSDWGSAAYYGLHL
TYDAPSDFAFAALGMRDTQPWKHRVKMLALEGQVYERDVGNPSVAILGRFDFAFFAAFVFPLVLMVLLYDLRAHERSAGR
INLIEATVAQPRLFWLQRASIRTLAVLLCLIVPLIIGGLIAEVSALKLVLACLAVIAYGVFWGLVCFWFSAWRKQGQLIL
ISLIALWVMTAVLIPSAARLAIDRAVPVPDGADILMLQRETVNDAWDLPRKMTMDAFFERHPQWADYQPVESSFEWQWYY
AFQQVGDQRAEPLAMAYREGRKRRAELATWLSVFAPPSLLEQTLQALANTDAHASLEYEERVRAFHAELRAFYYPLFFRN
VAFDRELLEDLPNFDVH