TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q22397|Q22397_CAEEL Protein AAT-6, isoform a OS=Caenorhabditis elegans GN=aat-6 PE=2 SV=2
MLNVFGVSASMPDDSRSQKMGLLGAISYIVGNIVGSGIFITPTSIIENVNSVGLSLAIWILAAFISMLGSFCYVELGTSI
RLSGGDFAYLCFMKWYPVAFAFMCIGCTINYPATLAVQAQTFAEYVFRGAGVELDETSEFWAKKLLGFSLIILLMFMNFF
SLKTFVQRFSILASLAKIAATLLIIITGFYYLIFKHWKQNLEEPFKGSNWNPGPFVNALFAGLFSYDGWDILNFGAEEIE
NPKRTMPLSIIIGMTCIGVIYVAVNVAYSIVLSPTEMIASNAVAIDFANKTLGAAAFVVPVMVAILLIGSLNSTMFSASR
YLQAVSRQGHIPSAISGIAPNCDSPRVALLVHILIAIAVSFLGDPDKLINYVAFAQWSQRAFTMSALLYLRIRGRPRHPD
RIQLPIIMPILFFLVCTSMVVISIIDDFKSSAVGLGILLGGLIIFIIFVWDRALPSSHTFRNATHVINEESTKFMQIIFN
VVPERVGDEEMKNAIGGAESESEKVPAYKISPTGNGQFKCTRM