TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q22WA5|Q22WA5_TETTS LMBR1-like conserved region family protein OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_00158290 PE=4 SV=2
MRIFSVVECTIYLIFIAYLVYEYSSKKVPYYVKIITYISWVISFGFVFVLPLDIYYTQHNLSLKRHNLDPKLLDTYEIKY
IELTWSVIYWINFLLIWFILPILQEFEDAGEFTIKDKLKRSLYNNALLYGIFVLLGGLFMIYLSYYGKMTMSAMMEFFAG
LSNCFGTFLVILLMGHGLVAIPKKYINERTQELNLKYYQGIAKKSEQTKVNAKYQMERLIKIVYLMKEQYSDKHVGQYCT
KILEEVNPQIMNDVIKDLRYTNLEDLSRDLTDINMNKIVSLNRQVKKSIADYLRAETKWQILLDNAFLVEDILENQFSIH
YKIRSTFWVERSGYVGDILDKIQWFWYVKIKSILKLVLGVIFSIFSLIIIYGELSMFLDLDISIFKIFSQSDEYFKTQIL
ILIPLLYISFCSYYGLFHIQFSGFYCFFKHHNTDAPSLLFGSINFSRVSAPLCYNFLQMMRIQNTSCEQVIGKFDTSVFG
SFSAVFFPVVLIIFTLFNFFDIYDLIVEKFNLQQLEFSHQPIQSDIDEGKKILYKARLHRERKFLTKQSTDLRNFNGYSI
NQFSTRISMYNDDENRNIIPYENQQNKQRSFSTSSLLTNSRNSNFYKDILKI