TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q23GC1|Q23GC1_TETTS 14-3-3 family epsilon domain protein OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_00075440 PE=4 SV=2
MPQYLWYIIQIQTLSLKYTTNIFQLVEILISFLQQQKNVNSFIILIEIRKYHPIFFENKLFLYQIQNNMKSNLNYQIFKI
KLNKVKEKNKINKMDNNLNHFQFKIHQLSREELAYALKLSSRLERYDEVLEIVKLLSMHNEQLCEEEYKLFDKALSFYFC
SKIQPIKKMEQKNLDYYQYEKLGQNFLQNIINNYKLNIISESEEMIQTIERLLMNKNISDLQRYYCYSIRGDCYRYIAEN
NLGNIHLVDDALQAYFQAEENLRDTKDYG