TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q23K98|Q23K98_TETTH Cation channel family protein OS=Tetrahymena thermophila SB210 GN=TTHERM_00194370 PE=4 SV=1
MSQVKFGDYITIQGTLLDKNNTNGAHYGYMCTTGFTNNEIYLEKQSKSIFANTSNQDQQISQKPEDNVFSIKNYREYVFQ
IWPKLDYDAHKKYSKLLEEKNQIQKKLKSSKDNIDISEEDQERMKEYLNEVREKIKIAKIAKESEKANNLKQLESVKGNF
VCYGQEIFLMHADSQSFLNGLLQASVSEKSAFMLQVTKFFQRGMVFKFQPKYKLRKEGEIIQYKDQISIFNVKQQCWANF
VPSNITQQDKIIQGPTPTNYYQSIDFQKYQNRQRKKFFKLNFALIERGLLIFIELQLIINRVEVFLTKVKEAFWQIHIHS
DYIQNQETSIKGGDLIYLYHTELQGALTADISYDNKKGYSEAYIRKYQGEYELEKYSVASIWEIEKDSCFDRGSNIPVSS
LSNQDKKSTQSFKIRHFLTGKVLSIQQVNQGQYIPCLAKDDLTTLENSSKIQFVSTQNDENEIMEDNHCYLIKINDQFIQ
ANSSIQYTVQKHEKNSENKLNVTDFKDVTENMIYKPIDDSEFEVYRNGLTCVDKGSTEENAFQVIKLTEEEKQNILYVNS
SLNILHKFLQKLRNVPYREPLPKKEYIKKVGQILSDLVLFVVKTESKNPLECEGIPIPKRQKIMKDYKFIELLVDLLYYP
FKTEVYKMKELDQIDPDTVKIFKLCNVLINNSIKEYRPNEIYASQWINLLIFQSEMTEGYCDIGSEETLTELIDNNKKIL
ETIDEVTVNKFLQMLMENQNKKYVKLIRALILCNGQPVHNQELISNYLLSGMDAISNDEDETGQRQVDINKPLIIQAVKY
INGEVWVQSPFKENYGKFMLLSKFQEMSTESQENLDKFEYFSEMIGMLSDLCKSRNYTAINQLVHVYKRRVCFEIVQNSL
FDPYLRRSFVMLIHTMYLDISDFKKFSLPNNIRVWTEIEKAKSIVSVYDQQQNLEKVMGLNSFVSPLLYASNHLKVFSIE
YIIGIAKSKYMSSLKEPENLLTYSILQMIQDLVDFGFFDNSDELESLVKNIIKILDSSLDVGNQNEEEAAEEVVKLLSCR
TTISKGNIPQALKKLNHIQISRFTGRYEHTEDNLIVHECKTICCEILKKVILIRNDMRITQFMKKFKNEFDLITTFKPMN
KNSKKKPSMKPLEIENPIQQFQRKRNPSDTPNSVNQSHIQGDKSPLINEVFSNQLKIEEGIQDVSEQERRQISQALAKRS
QEMLDENTIKLRGCLKVDVVAIFQDLTLYQNSDLVNNSFEILNMLFTERQEILNLLQNLQLLEDHEQIQSYFSMKQIQDN
LSEQVEKSENWLFKYEEANIKEAVKVEINLQQIVQIQAQKLQGLPLPVIGIEQGEDTGRLLNQKQDYNQGIRQEAINFIE
QLFEEDEVKNQYSQELIRNSYLYQQIIDLLNYDANTFTRKRQEEGINKLNFNDTSVFIRILRLCYKILGRLVIGNKQNQI
LLTDQVTDFIFKHMKYLPQSYPHLLLDPLIEQNSLLIMHEEICRKFVKEIFNCINILKSHNILNLVSCYLDILKKIPYVN
DIIVKENQTIIMDLLTSKENQNLLSFINFDDPSYKQLIHSSQQFQNFVDSGQEEIIDVPQELDYFDSLLSLMAAVCDSKN
NATESKAQSYISLYQLKELLIKFKNCFYVKRSLYFFFFHVYLDTEKEMSDQLLEIKKFIIQSIEDDLILITNNLDVQDIQ
LLNYKGKISLQKIKLEYIFESLFLCVDTILCKKLLDTSSEKQFLTQLLESIIKVSQLSVLKQTHKRKLKGILIQLVVRGF
TSIQKLKQHNQIIPNLLEVRQTQKNLQDYFSTTIQISHESTVQLSQKQATLLDVIKKLKKSEILQEEIRKEFKNFVDYFT
DIKYISLKAFQGLCTIEFSELTTAMIKLMVQNRFVNDYDNTQNELEKKRLQVLRQIIELENPESNDSIDLWDSLEGFEEE
IIKRQNQLIQQGVAEMIVEIIKDPQASSDIKEEAILLGIALLIGGNAKTQDEFLKALSSDSNNQFLGVLYDMITRGLLLI
KKNMSKLNKQVEFKLIEEQKQALDQQINLNDEDFDDKLSDDEAADVMDSQDDDEESQIPQNVECLLINIIFQFIKQNIKV
IQEIRRIRRVYRLLQLFCEGHNNQFQNHLRQQIIDQQESGKSIDFIMNTTILFSSAVKYLNIHCIDLIDQILDFLIESIQ
GPCVENQITMCRGKINETCKDLLQKFQGNQEQNKQYYILGFDTEENKEELESLISKSFKLLYSLIEGDPSKDILQQMCQT
LDFNHLFQILDDKFKKILQQLNISFVQTLNFSDEKIRKIVDRLDSHFDESLEGVFDIYLLISTLSDKDENVKQLLENPPD
EYVSALKFFKYNTASIEVVFKNNLIRVYFPIQPICRLLSKNSRATLMEEIPRSTTSEKIEGLVEATIDLFDEMEHLAFLK
KQIFNFSSNRLQALMLISYTFALAINLTILFTYKLTFEEFQKAKNYINPGALTTTVVFGIIQFITVLIIILFYIIIHGPL
IIKRSWHAIQEENEVKCYQTQNFIQIKSLKKQKFKKPQEEERIIEAKYLSLRDAVSVLMTKGPNAEEFWKSGKRDFGHFF
VAFFYYWRNFQTMMRQGSFIYLLFYVIVSAMGLFVSDITYCLLLLDIIARFPTLQNVVKAVTTNIRQIGLTTLLGAVLIY
IYSIFAFYFSDQTYKTTEVYGLDGEKGDQNTCTTLFQCYLYTLNQGLLHAAGIGEAIAKPSYEDPSTFIFRYFFDLSFFM
IINIMFLNFIFGIIIDTFAQLRDEKQKKEEDKNNVCFICGLSRNEFDKVPGGFTIHIEKQHQLWYYVYYIYHLKCKDSTE
YNGVESYIQDLLNKQQTTWFPLLKALSLSKSEDQNQESQIENKFEKLKSGLKDVTSKVEKISSKKIEKKKNK