TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q27257 DIF-1 PROTEIN - Caenorhabditis elegans.
MSDVLLNFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKPGEKPQFTGALDCVKRTVSKEGFFALYKGMAAPLVGVSPLF
AVFFGGCAVGKWLQQTDPSQEMTFIQNANAGALAGVFTTIVMVPGERIKCLLQVQQAGSAGSGVHYDGPLDVVKKLYKQG
GISSIYRGTGATLLRDIPASAAYLSVYEYLKKKFSGEGAQRTLSPGATLMAGGLAGIANWGVCIPADVLKSRLQTAPEGK
YPDGIRGVLREVLREEGPRALFKGFWPVMLRAFPANAACFFGLELTLAAFRYFGIGGHPTPSTEVVPLPHDE