TCDB is operated by the Saier Lab Bioinformatics Group
>Q2AAU4|Q2AAU4_VIBPA Membrane fusion protein VmeA - Vibrio parahaemolyticus.
MRRRTTLSLLIASSLFMAGCQPSQEGTEQGGGAAPATEVNVLTVEPVRQALTVELPGRSRAFKEAEVRPQVTGIISERNF
VEGGVVEKGQSLYQIDDSSFQADLLSAEAELIRAQASEESTFATVKRYRALITKKSISQQDLDEAEAAYKEAKAQVLVAK
AKINTAKINLTYTRVKAPISGVISKSNVTAGALVTANQADKLTTIQQLDPINVDIVQSSAQLLRLKAALSQGHMQEDQSA
QVALTLEDGSTYEHKGTMKFTEVNVDESTGSVTLRAEFPNPDGLLLPGMFVRATVITGVDPSAILIPQNTVTRDATGKAS
VMTVSADNTVAITPVITAEVIDNQWRIIDGLKAGDQVITAGLQKVRPGSPVTIQTGEQG