TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q2J5C0|Q2J5C0_FRASC Copper resistance protein CopC OS=Frankia sp. (strain CcI3) GN=Francci3_4174 PE=4 SV=1
MRRILVVAVTFLVMATTSIGFGLGVPPASAHALLTGSDPVDGAALDVAPTRVTLDYSESVRVSRDSIRVLDSAGRRVDDG
RAGSGPKASQATVALRPGLPNGTYVASWRVISADSHPVSGALAFGVGGPPDAAAAAASGTSGSSTVGVVFAMARFLGYAA
TALLLGVCFFLIVLWPTGLRAAGPGRLLMAAWGLSVFAAFAQLLLQGPYAAGLGLGGLGQWSVLSTTLADRFGHLLLIRL
LALALMVPLVRRLLRTGSVDPRGNGELAGLGVVVAVTLAMIGHASVGDLAWLATTSTTVHVIAMSVWIGGLVMIAGFLVR
RASATELAEILPRWSKIAVVAVVAVMVSGVFQGWREVGPPRALIDTSYGRLLVYKVWLVLGMIALGALARRWVRRQYRTN
RNQPAGRPDRSSHAVLLAGLRRGVMAEIVLGAVVLGITAGLVNMVPGRTSYSPPFSDTTFAGPMTVKVRVSPTRVGAQTL
DVQATDPSGKPQKLVEASVALSLPAADLGPFTVPLSLAAPGHARSDGIRAPLPGEWQLRLTLRVNDFDQYVTTVFYQVR