TCDB is operated by the Saier Lab Bioinformatics Group
>Q2J9P4|Q2J9P4_FRASC Putative uncharacterized protein - Frankia sp. (strain CcI3).
MLRATLKSLLARKVRLVLSMLAVVAGVSFVTGTLVLTDTLNRTFDTLFADINKNVSVAVRSVNAIDPTSDVGRPPLPASL
VSTAAGVDGVRVAVGKVNGQAVLVNPATGKPSNTNGAPGIGINWTGGQPTSAEEIAEGRPPGPGEIVVDRATAKKLHLSL
GAKISVQTKGPPARYTLVGTFRIGGQDSLGGAAVTAFDTATAQRVLLAPDRFSAIHLAAGPGLTQEELRARVAAALPPGV
EAITGRQLADESASAVQNAVSGFSTFLLIFAAISVFVGAFIIFNTFTMLVAQRVRELALLRAIGASKRQVQVSLQVEAAL
VGFAGATVGLVSGAGLALLLRVAVGVFGVALPSGALVFRPRTVVIAYAVGVLITAAAAFVPARKAASVPPIAAMRETYVL
PTRSLRSRAIAGSVLTALGIVLLILGTASAGKPGATAVGVGAAGIFLGVATLSPLLSGPITRVLGAPLARMFGATGRLGR
ENAMRNPRRTASTASALMIGLALVSAFSVLGQSIKESVRETVSNSLGADFYLTPQNFGQGFSGEVARELAGKPGIEIATG
LRGGLVKISGQSSQVLAGDPAGLVKMLAIKEVTGDVHALGDGTILAEDSTAADHQLRVGQKVPVTFADGRAELTLVGTYQ
KSQVAGKWIISTSEFARHSTDDLDLFVLVKRASGADPAMVRAEIATVVKSFATVEVRDQSEFVAQQEKQVDQLLGFIYVL
LALAVIIALFGIVNTLALSVIERTREIGLLRAVGMTRSQMRLMVILESVIISVFGAVLGVVVGSIFGWALTKALASLGIS
TFAYPVRTILLVVLTGAILGVLAAVFPARRAARMDVLRAISAV