TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q2LWK9|Q2LWK9_SYNAS WbfB protein OS=Syntrophus aciditrophicus (strain SB) GN=SYNAS_25900 PE=4 SV=1
MLRYLNAFLWVCVCWFALWCSAPAQAGDEPFNGPANWGGTGLLETPTARVMPEGKFRVGFSQVDPYRRYYGAVSPLKGLE
LDGKVTEFLGVTANPNSSPDWEGYGNDKDKSFDLKHQFLAEGKYRPAVALGIMDPHGTRKFPSQYLVMSKQIYPFDFTLG
FGNGRYGKNPLPAQGEGFRVEILSDPRSWLEDSQFFGGIEFAPSERFSFILEYSPIRYEKQTGDSAQAKYFQEPVPSKWN
IGLRWKPVDWAEIDVSWQRGEQLGVNLSTSFDLGKPLVPIYDHPWREKPEFRSDPLAERLIRALYASGFRDIGIEASGDE
LRVEAANDRYFYTPAAVEVALRVLAQIVPPEFTTLRLTLTDRGIPLVALTALREDVCLFHQEKLTANQLYALSDGLKTDI
NETLAAEKHYRRYFDYGLKPEFQTFLNDPSGFFKYRAGVSGWLSLTPWRGGSFIAGLQGFPLNTVSSSNEPLSKPVRTDN
VPYMEKNVSLSMLMAEQIRKFDGEIYGRLSAGMLEVQYGGIDGEIARPFLGGRLMLGLSGSVVKKRDEDDPLKFKEDDWK
DTYTTAFVNARLNIPRLESAIDIKYGRFLAGDRGTRITLSRFFNGLELSAWYSWTDTDGFSDSHNRGYHDKGIAVTIPLR
LFKGSDSRTVYKYSLSPWTRDVAQDIDHHTSLFDFIGRNTGIYLDKDWRN