TCDB is operated by the Saier Lab Bioinformatics Group
>Q2SDB0|Q2SDB0_HAHCH ABC-type transport system involved in multi-copper enzyme maturation, permease component - Hahella chejuensis (strain KCTC 2396).
MLPDKNVLRMAGKEVSQFFSSPVAFVFLAAFLAVNLFIFFWVEAFFARNIADVRPLFEWMPLLLIFLVAALTMRMWSDEK
RMGTIEFLMTLPVTPLQLVLGKFIACFILLLIAMALTLPIPITVSYLGHLDWGPVIGAYVAALCLGAAYLAIGLYVSAKN
ESQIVSLIITVLVCSLLYLLGSDTLVDLFGYSTGEVLKQLGTGSRFESITRGVIDIRDLYYYLSLVGVFLALNVLALEKQ
RWANSDGARSHHRAWYAVSGLMIANLFAANLWLSEVKTLRADLTDGNLYSINDATRDYLSQLQEPLLVRGYFSAKTHPLL
APLVPQLRDLIKEYEVAGGDKVRVEFVDPQSNPELEDEANNKYSIRPVPFQVSDKYQASLVNSYFNVLISYGDQFEVLGF
RDLIEVKDRNESDLDVRLRNPEYDITKAIKKVLYAYQSQGDLFATINTPVKLNGYVSSAQQLPPELQTLAQDLNDVLADI
KQESNGKFSYELQDPNAGDGSLAQQIQQDFGMQPMTTSLLSDDRFYFYLLMNDSKQYVQIALPDSLDKEGLKRNIESGLK
RFSAGFTKTLALVVPESDADPYMQQFGQQSSPSFKTLRDKLMETMTVKTIDLKDGLVPEDADILMLAAPESLSDKQLFAV
DQFLMKGGTVLLSTSPYQTRMTSSSLTAGKHTSGLETWLQNYGINLAQSMVLDPQNASFPIPVTRNVGGMSFREVRLLDY
PYFADIRDTGMNQDSAITSGLPNVTMSWASPIELDKEKTKALQVTELLRSSPQSWVSDKLDVTPRVSADGHISPWTSEGE
PESYLVGVALEGRFESSFKGKESPLLSEANNANEADQAPTEGGQAAQQDDKAEKTHFGGVIDKSPESARIILFSSNEFLN
DQTISLISSTERAPYLNSMQLVQNAVEWSLEDRSLLQIRSRSHFANTLYPMSAERQQFWEYLNYGLAIAGLALLYALFRL
WFNRRQSYYAGMLELGRA