TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q2SR52|Q2SR52_MYCCT Transporter protein, putative OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=MCAP_0814 PE=4 SV=1
MKTVEKWSQNNRMLYGTILWAFIGFGYLLFIANWAFAIGLAGGGIKDGVHSPGFLSYFQIENTASFQLIDKAANWAITFG
RGIGSVVVAFLLVKFAHKKATLIACIMTLFGLPAIFMPGAKYGYVLFLILRTVMAIGGTMLTILFQPVAANFFTKKTKPI
YSQIAIAFFPLGSIISLVPFVIAGDSASVDILRSNWRTIFLVMSLLYLIPLIAVFLLGTNFDVKKDSNEPKVNGFKVLKG
YLKTKATYAWLLVFGGWLIVAVFPTSLSLVLFPWISGLQNESMGTQIRIWQILFLFAGTIGPVVIGLWSRFNLKRRWYIA
TLIGFGIILFIISIVVYKYGLAPNYNKQTKSLEGNYKGWLVLFYILGFLTGFCTWGIEAVILNLPHEYKDADPKTIGWMF
SLIWGFGYMFFTLSLIIITSIPLIKSINQSTIAIIQLVLIVILGLMSFIGLLMLKEPKDDAKTFPSFKSKEKQVK