TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q31M69|Q31M69_SYNE7 Uncharacterized protein OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_1820 PE=3 SV=1
MSTSSNFRDAIREAQTSALVGPSVVRRALPFVGGGLVLTSVGVYGGLGVLGSNPSLFMPLWIGSIVLQLVLFFVAQGIAS
RGSNSTALPLLALYGLLTGFSLTGLISVALGSVGIGGLGVAALGCGITFILASIFGQKMSESTGQALTQTVTLGIGALFL
VMLVQLIGGIFIPALRGGLELLIAGAGTVLFIGAAFVDFYTLPRTYRDDQYLAAALSMYLTYINLFIFILRFLIAISGNS
RD