TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q3A8N9|Q3A8N9_PELCD Putative uncharacterized protein OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=Pcar_0519 PE=4 SV=1
MRKIIVAVLAMAILPGIAWAQEPSNQELYQMIQQMERKYDAAIKETDRALAEARAEAAKAKEEAAKAKAELARLKAEPRP
AAAALQAEATPLIKAPETTPGFKASAEVLYMRPSRANLDFAIKDPDNDSYPEGTVSEIEPDYQLGGRFGLGYDLGSGTEI
GVQFTGLKSHDSESATASSSGSLWGLWLHADASIDDQNVDTAKARYDFEHYAIDLNARQNLDIGRHLGLSLEGGLRYASM
NQDFDIVYRQNTTEVAINSENHFSGWGPRLGLGLDWRVGYGFNVFSSVAGSVLMGDFDLSYHDQDGTTTRVNMKQGIHNR
IIPVVEMKLGVGYAQRLKNGWTIGANAGYEWQNWFNMVTTHHFSDDVDPQIMDSDTTDVSLDGFFFEGFIHF