TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q3BQC3|Q3BQC3_XANC5 Putative major facilitator superfamily protein OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=XCV3309 PE=4 SV=1
MRRILGPVLAAHYLAAFTALGMPLFLPQVLAELAPSAAVGWSGVLYVLPTLCTALTASSWGRWADRHGRKRSLLRAQLGL
ALGFAIAGFAPSLTWLVIGLVVQGTCGGSLAAANAYLASQPQAGPLARALDWTQYSARLAMVSAPALLGMALALGPAQSL
YRALALLPLIAFALTWRLPADRPAARGHTAGKAATSSRHAAPSPASPRPHAAPLWPALLLAQFLFCFAMVVTFPYFIPYA
LARGAGHDALAGLLYSLPHLVYLVVLPWWRRGDSEAWLVPGLALFAVACVWQALLHDAVTLAAARLLFGFGMLFGLRGLN
RSLAHIASGHGAGRLFGRFDACGKWAGVFAGAAAGALAQASGPATPFLAAALAATVAALTVLVRFPSRRTADVAAHDA