TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q3INA7|Q3INA7_NATPD CopCD domain protein OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=NP_4610A PE=4 SV=1
MTHTRTFALVVVLLVALSVVAGPVSAHANLDSSTPANGAQVESVPEAVELSFTGDGIQSAEVAVIGPDDEDISGAVSVDG
TDRQQVTVPIDTAGDASGMYVVEWEVLADDGHTTSGSFFFTVGDGPADREVILDTLEDGVEAGTSWAEAVANGLLLGAIV
GLFGMAVAFKTAVMPVVAGRSHAGTGTLQRRAFRLCAALVGGLVAAVLAVGLVQLRLFGPLSAETAEGFLASSLGLVWSI
QLLSAVGLLAAVLFSVRRAAGTDTRPRPPLKAIAVGTFVVAAGVAATSHSATAVDGLLGGGVGLLHILGAGLWAGGLLAV
WVAVSGLDQQSSMASRIRIVGRIVRRYAVLAVAGVALLLSTGLFFASWHVGGAAGLRDTQYGLLLLGKLSGVAVGLAIGG
YHHFVVLPRLEGRPSLLSRLRGDPAATDGGSPAGLDRFGRTLRLEIGVLAVVVLLSGIVTATAPAAVALDAGEDTSEQIE
TTFDDAAGIESHIELQPTAAAADDELRLQDGQPVVVDVRFERDGDPVSATDGLELRATALDGGTNMNFDVEQHDDRYSAV
ITLPETGAWELRLVGDPDGVFGSVSLDVTVGGDPQSEASNEASDDDGGHDHEHDHGAGDLSEDPLQVGGVLVGIYGLLAV
GYQAQALTGRAEEGDGEEG