TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q3M879|Q3M879_ANAVT Uncharacterized protein OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=Ava_3199 PE=4 SV=1
MNNQFKLRIGLWSAAILTALVGVVNLLSAVTPNLYGRNHWLKEFLPFEIRATGHIFAALTGFILLALATNLLRRKRVAWM
LTVSLLIISIISHLLKGWDYEESILSGVLLLQLISMRHIFTAQSDRPSVARGVRVLIGALLFTLAYGTVGFYLLDDKFTE
NFNWGGAILQTLAMFFTEDNWGLQPKSRFGEFFANSIYVIAASTITFAVVMLLQPVFLRQTATISEQRKAKEIVQQYGRS
SLAPLTLLSDKSYYFSPSGRSVIAYVPKGRGAIALGDPIGPIEDRTEVISSFQEFCQRNDWYPAFYQTLPDDIDLYRSLG
FKVLKIGEEAIVDLPTFTLQGKAGKNFRPSINRLTKLGYQVSFHQPPISSELLHQLKSVSDEWLRMVQGSEKHFSLGWFD
EVYLRECEIAVVYTPDGKIDAFTNLLPEYQLNEVTIDLMRHRHAMENGTMDFLFTSLLQHFKDEGYDSFNFGLSALAGVG
EKPESQRLEKGLRYLYEHLNRFYNFQGLHAYKEKYHPRWEGRYLVYPSLTALPDVVVALIRADSGDRLLDYFQPGA