TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q3V161|Q3V161_MOUSE Kazal-like domain-containing protein OS=Mus musculus OX=10090 GN=Slco6c1 PE=2 SV=1
MAHVRNKKSDDKKAMVVAKEDTNKSESEGVTKLQTYLKTIPIAKKKFAKLPKRKKSPTSAELLLIDPRYSASKEGPLGLG
PIVLPFVQRFNNIDGFMTLYVAAVLIHGALFAVVDMTLNIYQVQFSLTRTEWYLMDFSDYIASFVVAIIIAHFGSKGNRT
RWIAASCILMGLESMLFAFPFFTYEIIIPGRQSIELCMEENEKRNIICGNSVPNRSKCIYFHIGGQCIHGIAGMPIYILG
ITFIFDHIPTSSCGFYLAIGHSAYLIGYLLGMVGGLQNFQPPPKEKTVEIEPAKVYQLLQSGWWKTFLIIAAISFCVSFM
MVCFPTSLPGAHKLRLAKRKEPPTIDRRLKDMKIQPHLKGFLHNIWHILKNPLMLTQAICKVSEYLTFNTSLYFLPHHLQ
TQFLITPGIASLLTGAFVLPGGIIGHFLGGLIVDRLEMTNKNKLKFTLVTTVVSVGLFLLIFFVECQTTTFAGINEDYDG
YGQLGNLTADCNEYCDCTTSLYTSICGRDEKEYFSPCFAGCKATKVSQTEKTYYNCSCIKEGLAASDDEGQFIDAIAGTC
DSDCLKLPLFFAFYFSATVFSNMCSIPVISIILQSVPANFTSLSLGVTYAIVKFVASVPAPLLFRLSSAIACIYWDNNRC
GGKERCWIYNKNILVYEFMGIWMSSQLIIVLLNIYAIQIHDVVVHGEITESKTTVKDVKEQKERKA